PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_31387
Common NameKK1_033633
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family BBR-BPC
Protein Properties Length: 238aa    MW: 26374.8 Da    PI: 8.8519
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_31387genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind83.38.9e-2611151104
      GAGA_bind   1 mdddgsre..rnkg.yyepa..aslkenl..glqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllven 89 
                    mdd g+re  r+k+ +y++a  + l +++   +q+m+++aerda+i+ernla+sekkaa+aerd+a+lqrd+a+aern+a++erdn++++l+++e+
  C.cajan_31387   1 MDDAGHREngRHKAdQYKSAqgQWLMQHQpsMKQIMAIMAERDAAIQERNLAISEKKAAYAERDVALLQRDAAIAERNNAILERDNAIATLQYRET 96 
                    9*****999*****9***655544444432146*************************************************************** PP

      GAGA_bind  90 sla....salpvgvqvlsg 104
                    sl+     ++p+g+q++++
  C.cajan_31387  97 SLSsgsmPSCPPGCQISRD 115
                    *998887799999999876 PP

2GAGA_bind264.36.8e-81122238185301
      GAGA_bind 185 erskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydls 280
                      ska++k +dl+ln+vs+Dest+P+PvCsCt +lrqCYkWGnGGWqSaCCttt+S+yPLP+++++r+aR++grKmS++af+klL++LaaeG+dls
  C.cajan_31387 122 AVSKADWKGQDLGLNQVSYDESTMPAPVCSCTSVLRQCYKWGNGGWQSACCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEGHDLS 217
                    569********************************************************************************************* PP

      GAGA_bind 281 npvDLkdhWAkHGtnkfvtir 301
                    npvDLkdhWAkHGtn+++ti+
  C.cajan_31387 218 NPVDLKDHWAKHGTNRYITIK 238
                    ********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062174.8E-14196IPR010409GAGA-binding transcriptional activator
SMARTSM012263.0E-1341238IPR010409GAGA-binding transcriptional activator
PfamPF062175.5E-77118238IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MDDAGHRENG RHKADQYKSA QGQWLMQHQP SMKQIMAIMA ERDAAIQERN LAISEKKAAY  60
AERDVALLQR DAAIAERNNA ILERDNAIAT LQYRETSLSS GSMPSCPPGC QISRDDLNKQ  120
LAVSKADWKG QDLGLNQVSY DESTMPAPVC SCTSVLRQCY KWGNGGWQSA CCTTTLSMYP  180
LPAVPNKRHA RVGGRKMSGS AFNKLLSRLA AEGHDLSNPV DLKDHWAKHG TNRYITIK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0936101e-165BT093610.1 Soybean clone JCVI-FLGm-24C8 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009116705.11e-111PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X2
RefseqXP_009116706.11e-111PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X2
SwissprotQ8S8C61e-95BPC4_ARATH; Protein BASIC PENTACYSTEINE4
TrEMBLA0A151RQK41e-180A0A151RQK4_CAJCA; Uncharacterized protein
STRINGGSMUA_Achr1P03770_0011e-115(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF69053449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21240.28e-92basic pentacysteine 4